PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0443s0100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 512aa    MW: 55649.7 Da    PI: 5.6316
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0443s0100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-39151211262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  SapurV1A.0443s0100.1.p 151 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 211
                             7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31148208IPR003851Zinc finger, Dof-type
PfamPF027014.1E-32153209IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975155209IPR003851Zinc finger, Dof-type
PROSITE patternPS013610157193IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MLEPKDPAIK LFGKTIQVTE ISVTTAVATT TTFIDDSQDQ DRISCADSSL CDTDTDNNKR  60
DHGEEDIEAD DKDPVEKKLI GKQEDGVSPV AEDGVSPVAT EELSNPDATS ATSENHKTTS  120
IEKESAALKT SKTEEEHSDT SNSQEKTLKK PDKILPCPRC NSMDTKFCYY NNYNVNQPRH  180
FCKNCQRYWT AGGTMRNVPV GAGRRKNKNS ASHCHHLTIP EALQNVRADV SNGVYHPSMK  240
TNGTVLTFGS DKPLHESMAS VLNLADKTTW KCTRNGSHKP EAVRVPVSYG SGENSDDHSN  300
GSSVTVSNSI DDAGKSMLKE SAVQNCQGFP PEIPCYPGVP WPYPWNSGTC PLPPPAFCPP  360
GFPMPFYPAA AYWGCTVPGA WNIPWLPQPS SPKQTSLSSG PNSPTLGKHS RDENMLKCSN  420
SEEGESAKEN NTERCLWIPK TLRIVDPGEA AKSSIWTTLG IKNDKPDSIG GQGLFKVFES  480
KAEKNHEAET SPVLQANPAA LSRSLQFQES S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008971.10.0PREDICTED: cyclic dof factor 3-like
RefseqXP_011013651.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLB9H0C10.0B9H0C1_POPTR; Ascorbate oxidase promoter-binding family protein
STRINGPOPTR_0004s12120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-108cycling DOF factor 2